Merck Anti-IGSF9 antibody produced in rabbit
다른 상품 둘러보기
Anti-IGSF9 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-IGSF9A, Anti-KIAA1355, Anti-Immunoglobulin superfamily, member 9, Anti-Nrt1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200-1:500
면역원 서열
TPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEVG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... IGSF9(57549)
The immunoglobulin superfamily member 9 (IGSF9) gene is mapped to human chromosome 1q23.2. IGSF9 codes for dendrite arborization and synapse maturation 1 (Dasm-1) protein, which plays a vital role in dendrite arborization at excitatory synapses. The encoded protein is expressed in developing nervous system and is characterized by an extracellular region containing five immunoglobulin domains and two fibronectin type III (FnIII) repeats, a transmembrane region and a cytoplasmic tail.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|