Merck Anti-FZD8 antibody produced in rabbit
다른 상품 둘러보기
Anti-FZD8 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Frizzled homolog 8 (Drosophila)
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
GSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... FZD8(8325)
Frizzled class receptor 8 (FZD8) belongs to the frizzled family of receptors and encodes a wingless/integrase-1 (WNT) receptor. It consists of frizzled like cysteine-rich domain, seven transmembrane domains, and a C-terminal Ser/Thr-X-Val motif. The protein is expressed in brain, kidney, heart, pancreas and skeletal muscle. The gene is located on human chromosome 10p11.21. It is a cancer associated gene.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.