CacheBy
Merck Anti-SCD5 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-SCD5 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-SCD5 폴리클로날 항체로, 인간 SCD5 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품이며, 면역조직화학(IHC)에 적합합니다. −20°C에서 보관하며, 25 μL 소포장으로 제공됩니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-SCD5 antibody produced in rabbit

Anti-SCD5 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution

관련 항체명:
Anti-Scd4, Anti-Stearoyl-coa desaturase 5, Anti-Hscd5, Anti-Acod4, Anti-Fads4, Anti-Flj21032


제품 사양

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
Species Reactivity Human
포장 Antibody small pack of 25 μL
적용 기술 Immunohistochemistry (IHC): 1:20–1:50
면역원 서열 NTQHIQKEGRALNQEAACEMLREWHQGHILKVTLPGLHILALLHTHCNHSEKCCLMLRALSVSLEVF
UniProt 수납 번호 Q86SK9
배송 상태 Wet ice
저장 온도 −20°C

유전자 정보

Gene: human SCD5 (79966)

The stearoyl-CoA desaturase 5 (SCD5) gene, with five exons and four introns, is mapped to human chromosome 4q21.22.1.
The encoded protein belongs to the family of stearoyl-CoA desaturases (SCD) and is highly expressed in the brain and pancreas.

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.