Merck Anti-SBNO2 antibody produced in rabbit
다른 상품 둘러보기
Anti-SBNO2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Stno, Anti-strawberry notch homolog 2 (Drosophila), Anti-FLJ00173, Anti-Sno, Anti-KIAA0963
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
LHCPYWNTFSLPPYPAFSSDSRPFMSSASFLGSQPCPDTSYAPVATASSLPPKTCDFAQDSSYFEDFSNISIFSSSVD
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SBNO2(22904)
Strawberry notch homologue 2 (Sbno2) is encoded by the gene mapped to human chromosome 19p13.3. The encoded protein belongs to the strawberry notch family of helicase transcriptional corepressors. Sbno2 is expressed at high levels in hematopoietic cells such as spleen and bone marrow. It is also expressed at low levels in the kidney, liver, brain, skin, heart and muscles.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.