Merck Anti-NECTIN1 antibody produced in rabbit

상품 한눈에 보기

Merck의 Anti-NECTIN1 rabbit polyclonal antibody로, 인간 Nectin-1 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품이며, 면역조직화학(IHC)에 적합합니다. 친화력 분리된 항체로 −20°C에서 보관하며, 25 μL 소포장으로 제공됩니다.

브랜드: Merck Sigma
카테고리: Polyclonal Antibodies
판매단위: pk

#Merck #Sigma #Merck Sigma

카탈로그

1개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

마지막 업데이트 2026. 01. 28. 오후 05:41

카탈로그 번호 · 상품 설명출고판매가담기

Merck HPA026846-100UL Anti-NECTIN1 antibody produced in rabbit, 100uL pk판매 단위 pk ·

재고 확인 필요재고 확인 필요

840,700원VAT 포함 924,770원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Merck Sigma · Merck Anti-NECTIN1 antibody produced in rabbit

Anti-NECTIN1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution.

제품 스펙

항목	내용
생물학적 소스	Rabbit
품질 등급	100
결합	Unconjugated
항체 형태	Affinity isolated antibody
항체 유형	Primary antibody
클론	Polyclonal
제품 라인	Prestige Antibodies® Powered by Atlas Antibodies
형태	Buffered aqueous glycerol solution
반응 종	Human
포장	25 μL (small pack)
적용 기술	Immunohistochemistry (1:50–1:200)
면역원 서열	DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
배송 상태	Wet ice
저장 온도	−20°C

Gene Information

Human [PVRL1 (5818)]
Poliovirus receptor-related 1 (PVRL1), also known as nectin-1, is a member of the immunoglobulin super-family.
The gene coding for this protein is mapped to human chromosome 11q23.2.
The encoded protein contains one V-like domain and two C2-like domains.