상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA026846-100UL | - | Merck HPA026846-100UL Anti-NECTIN1 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 868,530원 | - | 955,383원 |
Anti-NECTIN1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-CD111 antigen, Anti-Herpesvirus Ig-like receptor, Anti-Poliovirus receptor-related protein 1, Anti-OFC7, Anti-CD111, Anti-PVRR1, Anti-PVRL1, Anti-Nectin-1, Anti-PRR1, Anti-PRR, Anti-SK-12, Anti-Herpes virus entry mediator C, Anti-ED4, Anti-HIgR, Anti-HVEC, Anti-HveC, Anti-CLPED1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PVRL1(5818)
Poliovirus receptor-related 1 (PVRL1), also known as nectin-1, is a member of immunoglobulin super-family. The gene coding for this protein is mapped to human chromosome 11q23.2. The encoded protein is characterized with ectodomain containing one V-like domain and two C2 like -domain.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.