Merck Anti-TMEM30A antibody produced in rabbit
다른 상품 둘러보기
Anti-TMEM30A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-FLJ10856, Anti-C6orf67, Anti-CDC50A, Anti-transmembrane protein 30A
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50-1:200
면역원 서열
VKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFI
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... TMEM30A(55754)
TMEM30A (transmembrane protein 30A) is a functional homolog of Saccharomyces cerevisiae Lem3p protein. It has the conserved sequence QNHRRYVKS and is a transmembrane protein. The corresponding mRNA has a wide range of tissue expression. In cells expressing high level of TMEM30A, a major portion of this protein localizes to organelles such as, mitochondria, endoplasmic reticulum (ER) and Golgi bodies. This gene is localized to human chromosome 6q14.1, and encodes a protein composed of 361 amino acids. TMEM30A is also called CDC50A (cell division cycle protein 50A) and is a member of CDC50 family, which in humans includes- CDC50A, CDC50B and CDC50C.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|