Merck Anti-MEF2C antibody produced in rabbit
다른 상품 둘러보기
Anti-MEF2C antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
western blot: 0.04-0.4 μg/mL
면역원 서열
PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... MEF2C(4208)
MEF2C (myocyte enhancer factor 2C) belongs to Myocyte enhancer factor 2 (MEF2) protein family, which in turn belongs to a family of transcriptional regulators called MADS (MCMI, agamous, deficiens, serum response factor)-box. Four different forms of MEF2 protein are found in vertebrates, namely, MEF2A, MEF2B, MEF2C, and MEF2D. MEF2C is predominantly expressed in brain and skeletal muscle. It shares the common DNA-binding and dimerization domain present at the N-terminal, with other MEF2 proteins. Alternative splicing produces two MEF2C variants, which lack α exon. These MEF2Cα- are ubiquitously expressed, but at a lower level than MEF2Cα+ variants. MEF2Cα- variants are also less expressed in other tissues, as opposed to brain and heart. Alternative splicing also produces either MEF2Cγ+ or MEF2Cγ- isoforms. MEF2Cγ- is the major isoform expressed in differentiating myocytes and adult tissues. MEF2C is mapped to chromosome 5q14.3.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|