AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-MED12 antibody produced in rabbit
상품 한눈에 보기
Rabbit에서 생산된 Anti-MED12 polyclonal 항체로, 인간 MED12 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인의 고품질 항체로, IHC에 적합하며 −20°C에서 보관합니다. Affinity purified, unconjugated 형태의 primary antibody입니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-MED12 antibody produced in rabbit
Anti-MED12 antibody produced in rabbit
Ab1, Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 개요
Rabbit에서 생산된 polyclonal anti-MED12 항체로, 인간 MED12 단백질을 인식합니다. Prestige Antibodies® 라인의 고품질 항체이며, 독립적으로 검증된 Enhanced Validation 항체입니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibody |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Formulation | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | Small pack of 25 μL |
| Enhanced validation | Independent (Antibody Enhanced Validation) |
| Technique(s) | Immunohistochemistry (1:20–1:50) |
| Immunogen sequence | RLLLYHTHLRPRPRAYYLEPLPLPPEDEEPPAPTLLEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKKRSQPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQ |
| UniProt accession no. | Q93074 |
| Shipping conditions | Wet ice |
| Storage temperature | −20°C |
| Gene information | Human MED12 (9968) |
Gene Information
Mediator of RNA polymerase II transcription subunit 12 recombinant protein epitope signature tag (PrEST)
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.