Merck Anti-CLEC4D antibody produced in rabbit
다른 상품 둘러보기
Anti-CLEC4D antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
KLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CLEC4D(338339)
CLEC4D (C-type lectin domain family 4, member D) is a cell surface type II membrane glycoprotein. It is a member of the calcium-dependent lectin family (C-type lectin). It is expressed in the bone marrow, spleen, telomeric region of the NK (natural killer) gene complex and lesser extent in lung and lymph nodes. It is mainly involved in the macrophage functioning. In humans, the expression of CLEC4D is up-regulated by IL6, TNF, IFNγ, and IL10.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|