CacheBy
Merck Anti-CLPP antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-CLPP antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-CLPP 항체로, 인간·쥐·랫트에 반응합니다. Prestige Antibodies® 라인으로 RNAi knockdown으로 검증되었습니다. Western blot, IF, IHC 등 다양한 실험에 사용 가능하며 −20°C에서 보관합니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-CLPP antibody produced in rabbit

Anti-CLPP antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution


제품 정보

항목 내용
생물학적 소스 Rabbit
품질 등급 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
Species reactivity Rat, Human, Mouse
포장 Antibody small pack of 25 μL
향상된 검증 RNAi knockdown (Antibody Enhanced Validation)
적용 기술 Immunoblotting: 0.04–0.4 μg/mL
Immunofluorescence: 0.25–2 μg/mL
Immunohistochemistry: 1:200–1:500
면역원 서열 MGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPA
UniProt 수납 번호 Q16740
배송 상태 Wet ice
저장 온도 −20 °C

Gene Information

Gene: CLPP (8192)
Description: CLPP (caseinolytic mitochondrial matrix peptidase proteolytic subunit) protein contains an aqueous chamber formed by face-to-face assembly of the two heptameric rings that have proteolytic active sites within. The gene is localized to human chromosome 19p13.3.

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.