Merck Anti-TJP2 antibody produced in rabbit
다른 상품 둘러보기
Anti-TJP2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... TJP2(9414)
Tight junction protein 2 (TJP2), a junction-associated protein, belongs to the membrane-associated guanylate kinase (MAGUK) family with two isoforms ZO (zonula occludens protein)-2A and ZO-2C. It has molecular mass of 160kDa. It is localized at the tight junctions (TJs) and adherens junctions (AJs) in epithelial and nonepithelial cells. It is present at AJs in nonepithelial cells, such as fibroblasts and cardiac muscle cells lacking TJs. In the amino-terminal region, it contains three PDZ (PSD95, Dlg1, zo-1) domains, one SH3 (src homology 3), and one GUK (guanylate kinase) domain followed by a short carboxy-terminal with non-dlg-like domain.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|