Merck Anti-TMOD3 antibody produced in rabbit
다른 상품 둘러보기
Anti-TMOD3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
rat, mouse, human
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
LEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKNIPIPTLKD
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... TMOD3(29766)
Tropomodulin 3 (TMOD3) is the actin-capping protein with molecular mass of 40kDa. It is an elongated molecule with the tropomyosin-independent actin-binding site at the C-terminus end. It has also been reported that the C-terminus end contains a leucine-rich repeat (LRR) domain. In N-terminal end, it has two tropomyosin-binding sites and a tropomyosin-dependent actin-binding site. It has a rod-like, helical coiled coil structure that forms a strand on the surface of actin filament with its N-terminus at the pointed end.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|