Merck Anti-KAT6B antibody produced in rabbit
다른 상품 둘러보기
Anti-KAT6B antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
western blot: 0.04-0.4 μg/mL
면역원 서열
KPVLRKAFQHQPGKKRQTEEEEGKDNHCFKNADPCRNNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKRGLSKWRQNKERKTGFKLNLYTPPETPMEPDEQVTVEEQKETSEGKTSPSPIRIEEEVKETGEAL
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... MYST4(23522)
Histone acetyltransferase MYST4 is an enzyme encoded by the MYST4 gene in humans and is mapped to chromosome band 10q22. It is referred to as qkf, MORF, MOZ2, GTPTS, MYST4, ZC2HC6B, querkopf and KAT6B. It is a 1781-residue protein and possesses similarity with MOZ (monocytic leukemia zinc finger protein). It is ubiquitously expressed in adult human tissues and has intrinsic histone acetyltransferase activity. It consists of histone acetyltransferase domain, a strong transcriptional repression domain at its N terminus and a strong activation domain at its C terminus.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|