Merck Anti-EQTN antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA015089-100UL | - | Merck HPA015089-100UL Anti-EQTN antibody produced in rabbit, 100uL pk | 재고문의 | 0 | pk | 895,700원 | - | 985,270원 |
다른 상품 둘러보기
Anti-EQTN antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
independent
recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:200-1:500
western blot: 0.04-0.4 μg/mL
면역원 서열
SCESQYSVNPELATMSYFHPSEGVSDTSFSKSAESSTFLGTTSSDMRRSGTRTSESKIMTDIISIGSDNEMHENDESVTR
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... C9orf11(54586)
EQTN (equatorin) is localized to human chromosome 9p21, and has no similarity to any known gene or protein. It spans ~13kb, and has eight exons. The encoded protein has 294 amino acids, and has a putative molecular weight of 32.8kb. Its C-terminal contains a putative leucine zipper, and it is predominantly expressed in the testis. It is also called Afaf (acrosome formation associated factor).
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|