Merck Anti-CHRM1 antibody produced in rabbit
다른 상품 둘러보기
Anti-CHRM1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:1000- 1:2500
면역원 서열
SETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CHRM1(1128)
The gene CHRM1 (cholinergic receptor, muscarinic 1) encodes a muscarinic cholinergic receptor that is the most abundant muscarinic receptor in the CNS (central nervous system). It is predominantly expressed in the neurons. It is a member of the muscarinic acetylcholine receptor family that conatins five subtypes, CHRM1-CHRM5. These subtypes have high homology but differ in signal transduction mediated via G protein-coupled pathways, resulting in varying physiological responses. The subtypes CHRM1, CHRM3, and CHRM5 have affinity for G proteins of the Gq/11 family and CHRM2 and CHRM4 bind to Gi/o-type G proteins. The gene is mapped to human chromosome 11q13.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|