Merck Anti-BTG3 antibody produced in rabbit
토끼에서 생산된 Anti-BTG3 항체로, 인간 BTG3 단백질을 인식하는 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로, 면역블롯 및 면역조직화학에 적합합니다. 친화 정제된 glycerol 완충 용액 형태로 제공되며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-BTG3 antibody produced in rabbit
Anti-BTG3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 (Quality Level) | 100 |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 (Form) | Buffered aqueous glycerol solution |
| 반응 종 (Species Reactivity) | Human |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Recombinant expression (Antibody Enhanced Validation) |
| 적용 기술 | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT |
| UniProt 수납 번호 | Q14201 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| 유전자 정보 | Human BTG3 (10950) |
Gene Information
The gene BTG family member 3 (BTG3) is mapped to human chromosome 21q21.1.
It belongs to the BTG (B-cell translocation gene) anti-proliferative protein family.
BTG3 expression is cell cycle dependent and peaks at the end of the G1 phase before entry into S phase.
In adult mice, BTG3 transcript is ubiquitously expressed, with highest levels in the heart, lung, kidney, and testis, and lower levels in spleen and skeletal muscle.
It is also detected in ovarian fiber cells and fallopian tube, and the protein is mainly localized in the nucleus.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.