
Merck Anti-BTG3 antibody produced in rabbit
토끼에서 생산된 Anti-BTG3 항체로, 인간 BTG3 단백질을 인식하는 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로, 면역블롯 및 면역조직화학에 적합합니다. 친화 정제된 glycerol 완충 용액 형태로 제공되며, −20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BTG3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 (Quality Level) | 100 |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 (Form) | Buffered aqueous glycerol solution |
| 반응 종 (Species Reactivity) | Human |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Recombinant expression (Antibody Enhanced Validation) |
| 적용 기술 | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT |
| UniProt 수납 번호 | Q14201 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| 유전자 정보 | Human BTG3 (10950) |
Gene Information
The gene BTG family member 3 (BTG3) is mapped to human chromosome 21q21.1.
It belongs to the BTG (B-cell translocation gene) anti-proliferative protein family.
BTG3 expression is cell cycle dependent and peaks at the end of the G1 phase before entry into S phase.
In adult mice, BTG3 transcript is ubiquitously expressed, with highest levels in the heart, lung, kidney, and testis, and lower levels in spleen and skeletal muscle.
It is also detected in ovarian fiber cells and fallopian tube, and the protein is mainly localized in the nucleus.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-LSMEM1 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-UBE2J1 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-BTG3 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-MS4A1 antibody produced in rabbit
793,800원

Merck Sigma
Merck Anti-TSPAN9 antibody produced in rabbit
951,160원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|