Merck Anti-MS4A1 antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA014391-100UL | - | Merck HPA014391-100UL Anti-MS4A1 antibody produced in rabbit, 100uL pk | 재고문의 | 0 | pk | 793,800원 | - | 873,180원 |
다른 상품 둘러보기
Anti-MS4A1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
MESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCY
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... MS4A1(931)
The gene MS4A1 (membrane spanning 4-domains A1) is also referred to as CD20 and is expressed on the surface of human B lymphocytes and to some extent on a small subset of T cells. The 33 to 35kDa, nonglycosylated protein has 4 membrane-spanning domains with both the amino and carboxy termini of the protein localized to the cytoplasm. The gene is mapped to human chromosome 11q12-13.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|