Merck Anti-STIM1 antibody produced in rabbit
다른 상품 둘러보기
Anti-STIM1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
TAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... STIM1(6786)
STIM1 (stromal interaction molecule 1) is a transmembrane protein, which spans the membrane once. It predominantly resides in endoplasmic reticulum (ER), though some of it is found in the plasma membrane. It has a canonical EF-hand (cEF) domain, two EF-hand domains, a hidden non Ca2+ binding EF-hand domain (hEF), and a sterile α motif (SAM). This is present in the N-terminal of the protein, which is located towards the lumen of ER. This gene is localized to human chromosome 11p15.5, and encodes a protein of 90kDa molecular weight, which is ubiquitously expressed.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|