
Merck Anti-GM2A antibody produced in rabbit
토끼에서 생산된 Anti-GM2A 폴리클로날 항체로 인간 GM2A 단백질을 인식. Prestige Antibodies® Powered by Atlas Antibodies 제품군으로 고품질 보증. 면역블롯팅 및 면역조직화학에 사용 가능. −20°C에서 보관하며 wet ice 상태로 배송.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GM2A antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution.
생물학적 소스
rabbit
제품 스펙
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| 결합 | unconjugated |
| 항체 형태 | affinity isolated antibody |
| 항체 유형 | primary antibodies |
| 클론 | polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | buffered aqueous glycerol solution |
| species reactivity | human |
| 포장 | antibody small pack of 25 μL |
| 향상된 검증 | orthogonal RNAseq |
| technique(s) | immunoblotting: 0.04–0.4 μg/mL immunohistochemistry: 1:200–1:500 |
| 면역원 서열 | EPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAA |
| UniProt 수납 번호 | P17900 |
| 배송 상태 | wet ice |
| 저장 온도 | −20°C |
Gene Information
GM2A (GM2 ganglioside activator) gene is mapped to human chromosome 5q33.1.
The 5′ end of the gene exhibits promoter activity. This region is rich in GC-content and contains promoter elements such as Sp1, AP2, cAMP-responsive element, and B-cell-specific activating protein.
The protein is abundantly expressed in placenta, bone marrow, mammary gland, bladder, lymph node, and spleen.
참고
Learn more about Antibody Enhanced Validation
제품 이미지
(이미지 없음)
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-PDE1B antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-BEND2 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-GM2A antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-UQCRC2 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-HACD3 antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|