Merck Anti-GM2A antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-GM2A 폴리클로날 항체로 인간 GM2A 단백질을 인식. Prestige Antibodies® Powered by Atlas Antibodies 제품군으로 고품질 보증. 면역블롯팅 및 면역조직화학에 사용 가능. −20°C에서 보관하며 wet ice 상태로 배송.

브랜드: Merck Sigma
카테고리: Polyclonal Antibodies

#Merck #Sigma #Merck Sigma

Merck Sigma · Merck Anti-GM2A antibody produced in rabbit

Anti-GM2A antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution.

생물학적 소스

rabbit

제품 스펙

항목	내용
Quality Level	100
결합	unconjugated
항체 형태	affinity isolated antibody
항체 유형	primary antibodies
클론	polyclonal
제품 라인	Prestige Antibodies® Powered by Atlas Antibodies
형태	buffered aqueous glycerol solution
species reactivity	human
포장	antibody small pack of 25 μL
향상된 검증	orthogonal RNAseq
technique(s)	immunoblotting: 0.04–0.4 μg/mL immunohistochemistry: 1:200–1:500
면역원 서열	EPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAA
UniProt 수납 번호	P17900
배송 상태	wet ice
저장 온도	−20°C

Gene Information

GM2A (GM2 ganglioside activator) gene is mapped to human chromosome 5q33.1.
The 5′ end of the gene exhibits promoter activity. This region is rich in GC-content and contains promoter elements such as Sp1, AP2, cAMP-responsive element, and B-cell-specific activating protein.
The protein is abundantly expressed in placenta, bone marrow, mammary gland, bladder, lymph node, and spleen.