
Merck Anti-ACSL3 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ACSL3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIM
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ACSL3(2181)
ACSL3 (acyl-CoA synthetase long-chain family member 3) is a member of the long chain family of acyl-CoA synthetases, which contains five members. This protein is localized to cytoplasmic lipid droplets and endoplasmic reticulum (ER). The N- and C-termini of this protein are intervened by an AMP-binding domain. It has a transmembrane domain, and a luminal region made of the first 20 amino acids. Both the N- and C-termini project into the cytoplasm, with the N-terminal having an amphipathic helical region which anchors the protein into the cytosolic leaflet of the ER and the phospholipid monolayer of lipid droplets. This gene is localized to human chromosome 2q36.1.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-SAMSN1 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-PAPPA2 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-ACSL3 antibody produced in rabbit
895,600원

Merck Sigma
Merck Anti-FAM3B antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-INPP5A antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
