Merck Anti-UGGT1 antibody produced in rabbit
Merck의 토끼 유래 Anti-UGGT1 항체로, 인간·마우스·랫트에 반응하며 polyclonal 형태입니다. Prestige Antibodies® 라인 제품으로 면역블롯(0.04–0.4 μg/mL) 및 면역조직화학(1:50–1:200)에 적합합니다. −20°C 보관, wet ice 배송.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UGGT1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
Unconjugated
항체 형태
Affinity isolated antibody
항체 유형
Primary antibodies
클론
Polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
Buffered aqueous glycerol solution
반응 종
Human, Mouse, Rat
향상된 검증
Independent
Learn more about Antibody Enhanced Validation
적용 기술
- Immunoblotting: 0.04–0.4 μg/mL
- Immunohistochemistry: 1:50–1:200
면역원 서열
KVKVEHVVSVLEKKYPYVEVNSILGIDSAYDRNRKEARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELETITMHKILETTTFFQRAVYLGELPHDQDVVEYIMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDYA
배송 상태
Wet ice
저장 온도
−20°C
Gene Information
Human: UGCGL1 (56886)
UGGT1 (UDP-glucose glycoprotein glucosyltransferase 1), also known as HUGT1, forms homologues of UGT with HUGT2.
It has a putative active site at the C-terminal and a folding sensor domain at the N-terminal.
This protein (~170 kDa) consists of 1555 amino acids and includes an N-terminal leader peptide that is cleaved to produce the mature form.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Type | Primary, Polyclonal |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human, Mouse, Rat |
| Validation | Independent |
| Techniques | Immunoblotting, Immunohistochemistry |
| Immunogen Sequence | Provided above |
| Shipping | Wet ice |
| Storage | −20°C |
제품 이미지
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Merck Sigma
Merck Anti-ETFA antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-ZFPL1 antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-UGGT1 antibody produced in rabbit
895,700원
Merck Sigma
Merck Anti-TMEM176A antibody produced in rabbit
887,370원
Merck Sigma
Merck Anti-PDZD11 antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|