AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-ETFA antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-ETFA polyclonal 항체로, 인간 ETFA 단백질을 인식합니다. Prestige Antibodies® 제품으로 높은 특이성과 신뢰성을 제공합니다. 면역형광, 면역조직화학, 웨스턴블롯 등에 적합하며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA018993-100UL Anti-ETFA antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-ETFA antibody produced in rabbit
Anti-ETFA antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
제품 개요
이 항체는 토끼에서 생산된 polyclonal 항체로, 인간의 electron transfer flavoprotein subunit α (ETFA)를 인식합니다. Prestige Antibodies® 라인의 제품으로, 높은 품질과 재현성을 제공합니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality level | 100 |
| Conjugate | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibody |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Formulation | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | 25 μL (small pack) |
| Validated applications | Orthogonal RNAseq, Independent validation |
| Techniques | Immunoblotting (0.04–0.4 μg/mL), Immunofluorescence (0.25–2 μg/mL), Immunohistochemistry (1:50–1:200) |
| Immunogen sequence | MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKCDKVAQDLCKVAGIAKVLVAQHDVYKGL |
| UniProt accession no. | P13804 |
| Shipping conditions | Wet ice |
| Storage temperature | −20°C |
| Gene information | Human ETFA (2108), located on chromosome 15q23; mitochondrial localization |
Gene Information
The gene electron transfer flavoprotein subunit α (ETFA) is mapped to human chromosome 15q23. The protein localizes in the mitochondria.
참고 링크
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.