Merck Anti-NFKB2 antibody produced in rabbit
다른 상품 둘러보기
Anti-NFKB2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
향상된 검증
orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
ICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQP
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... NFKB2(4791)
Nuclear factor-κ−B 2 (nfκb2) is a proto-oncogene mapped to human chromosome 10q24.1. The gene codes for NFκB2 subunit, also referred to as p100-p52, which is a member of NF-κB/Rel family of proteins. The encoded protein is characterized with a DNA-binding rel domain at its N-terminal end, a poly (G) hinge and an ankyrin domain at its C-terminal end. The native nfκb2 gene is localized to cytoplasm whereas the abnormal gene, which lacks IκB-like properties is expressed in nucleus.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|