
Merck Anti-BAIAP2L1 antibody produced in rabbit
Rabbit에서 생산된 Anti-BAIAP2L1 polyclonal antibody로, 인간 단백질을 인식하며 Prestige Antibodies® 제품군에 속함. Immunoblotting, Immunofluorescence, IHC에 적합. Buffered glycerol 용액 형태로 제공되며 −20°C에서 보관.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-BAIAP2L1 antibody produced in rabbit
Anti-BAIAP2L1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, Ab3
생물학적 소스
rabbit
품질 등급
100
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
향상된 검증
- orthogonal RNAseq
- independent
자세한 내용은 Antibody Enhanced Validation 문서를 참조하세요.
적용 기술
| Technique | Recommended Concentration |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunofluorescence | 0.25–2 μg/mL |
| Immunohistochemistry | 1:200–1:500 |
면역원 서열
DYLECLSMGAAADRRADSARTTSTFKAPASKPETAAPNDANGTAKPPFLSGENPFATVKLRPTVTNDRSAP
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human BAIAP2L1 (55971)
Brain-specific angiogenesis inhibitor 1 (BAI1)-associated protein 2-like 1 (BAIAP2L1), also known as insulin receptor tyrosine kinase substrate (IRTKS), is a 511 amino-acid protein with molecular weight of approximately 57 kDa.
The gene coding for this protein is mapped to human chromosome 7q21.3–q22.1.
BAIAP2L1 belongs to the insulin receptor substrate p53 (IRSp53) protein family.
The encoded protein contains bin–amphiphysin–rvs (BAR) domain involved in binding highly curved, negatively charged membranes and the SRC homology 3 (SH3) domain involved in multiple protein–protein interactions.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



