Merck Anti-WIPI2 antibody produced in rabbit
다른 상품 둘러보기
Anti-WIPI2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2
Anti-WD repeat domain phosphoinositide-interacting protein 2, Anti-WIPI-2, Anti-WIPI49-like protein 2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
MKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASEKGTVIRVF
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... WIPI2(26100)
WD repeat domain, phosphoinositide-interacting 2 belongs to the WIPI protein family. It is localized on the autophagy membrane and plasma membrane. Apart from this, it is also present on the membranes near the golgi cisternae. WIPI2 is a mammalian orthologous of Atg18, which is ubiquitously expressed in variety of cell lines.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.