Merck Anti-DDX42 antibody produced in rabbit
다른 상품 둘러보기
Anti-DDX42 antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Anti-SF3B8, Anti-SF3b125, Anti-RHELP, Anti-RNAHP
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
form
buffered aqueous glycerol solution
species reactivity
mouse, rat, human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
western blot: 0.04-0.4 μg/mL
면역원 서열
FGATSSSSGFGKSAPPQLPSFYKIGSKRANFDEENAYFEDEEEDSSNVDLPYIPAENSPTRQQFHSKPVDSDSDDDPLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDD
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... DDX42(11325)
The gene DDX42 (DEAD-box helicase 42) belongs to the Asp-Glu-Ala-Asp (DEAD) box protein family. The DEAD-box proteins contain nine conserved motifs that function in the regulation of ATPase and helicase activities. They participate in all RNA-related processes, including transcription and decay.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.