상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA035787-100UL | - | Merck HPA035787-100UL Anti-TMPRSS2 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 868,530원 | - | 955,383원 |
Anti-TMPRSS2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT
UniProt 수납 번호
application(s)
research pathology
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... TMPRSS2(7113)
Transmembrane serine protease 2 (TMPRSS2) belongs to the membrane-anchored serine proteases (MASP) family, which is mainly expressed in the prostate. The gene TMPRSS2 codes for a prostate-specific androgen-responsive protease. This multimeric protein TMPRSS2 consists of a serine protease domain, a scavenger receptor cysteine-rich (SRCR) domain, a low-density lipoprotein receptor class A (LDLRA) domain and a transmembrane domain. The TMPRSS2 gene is located on human chromosome 21q22.3.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|