Merck Anti-MRC1 antibody produced in rabbit
다른 상품 둘러보기
Anti-MRC1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:1000-1:2500
면역원 서열
NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... MRC1(4360)
Mannose receptor, C type 1 (MRC1) is a trans-membrane glycoprotein, that is expressed at high levels in the M2 macrophages. This functional gene has 30 exons and is of 101.74 kb. MRC1 consists of a ricin b-type lectin domain (RICIN), a fibronectin type-II domain (FN2), 8 C-type lectin-like domains (CTLDs), a single transmembrane domain (TM) and a short cytosolic domain. It is also expressed on endothelial cells and plasma membrane. This gene is located on human chromosome 10p12.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|