AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-MRC1 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-MRC1 항체로 인간 MRC1 단백질을 검출하는데 적합. Prestige Antibodies® 라인 제품으로 면역블롯 및 면역조직화학에 사용 가능. 비결합형 폴리클로날 항체이며 −20°C에서 보관.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-MRC1 antibody produced in rabbit
Anti-MRC1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 향상된 검증 | Orthogonal RNAseq, Independent |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:1000–1:2500 |
| 면역원 서열 | NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG |
| UniProt 수납 번호 | P22897 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human MRC1(4360) |
Gene Description
Mannose receptor, C type 1 (MRC1) is a trans-membrane glycoprotein expressed at high levels in M2 macrophages. This functional gene has 30 exons and spans 101.74 kb.
MRC1 consists of a ricin b-type lectin domain (RICIN), a fibronectin type-II domain (FN2), eight C-type lectin-like domains (CTLDs), a single transmembrane domain (TM), and a short cytosolic domain. It is also expressed on endothelial cells and plasma membrane. This gene is located on human chromosome 10p12.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.