
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TGIF1 Antibody
상품 한눈에 보기
인간 TGIF1 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC 분석에 적합. PrEST 항원을 이용해 친화정제되었으며, 정교한 Orthogonal 검증으로 단백질 발현 신뢰도 확보. Rabbit 유래 IgG, 고순도 및 안정적인 보존용 PBS/glycerol buffer 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA062160-100 Anti-TGIF1 Antibody, TGFB-induced factor homeobox 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062160-25 Anti-TGIF1 Antibody, TGFB-induced factor homeobox 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TGIF1 Antibody
Anti-TGIF1 Antibody
TGFB-induced factor homeobox 1
Recommended Applications
- WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human TGIF1.
Alternative Gene Names
HPE4, TGIF
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | TGFB-induced factor homeobox 1 |
| Target Gene | TGIF1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQ |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000047407 (82%)
- Rat ENSRNOG00000015906 (77%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



