CacheBy
Atlas Antibodies Anti-TGIF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TGIF1 Antibody

상품 한눈에 보기

인간 TGIF1 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC 분석에 적합. PrEST 항원을 이용해 친화정제되었으며, 정교한 Orthogonal 검증으로 단백질 발현 신뢰도 확보. Rabbit 유래 IgG, 고순도 및 안정적인 보존용 PBS/glycerol buffer 포함.

카탈로그번호
HPA062160-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062160-100 Anti-TGIF1 Antibody, TGFB-induced factor homeobox 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062160-25 Anti-TGIF1 Antibody, TGFB-induced factor homeobox 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TGIF1 Antibody

Anti-TGIF1 Antibody

TGFB-induced factor homeobox 1

  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human TGIF1.

Alternative Gene Names

HPE4, TGIF

Open Datasheet

Target Information

항목 내용
Target Protein TGFB-induced factor homeobox 1
Target Gene TGIF1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000047407 (82%)
  • Rat ENSRNOG00000015906 (77%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.