
Atlas Antibodies Anti-TGIF1 Antibody
상품 한눈에 보기
인간 TGIF1 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC 분석에 적합. PrEST 항원을 이용해 친화정제되었으며, 정교한 Orthogonal 검증으로 단백질 발현 신뢰도 확보. Rabbit 유래 IgG, 고순도 및 안정적인 보존용 PBS/glycerol buffer 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TGIF1 Antibody
TGFB-induced factor homeobox 1
Recommended Applications
- WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human TGIF1.
Alternative Gene Names
HPE4, TGIF
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | TGFB-induced factor homeobox 1 |
| Target Gene | TGIF1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQ |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000047407 (82%)
- Rat ENSRNOG00000015906 (77%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TGIF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TGFBR3L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TGIF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TGFBRAP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TGFBRAP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.