CacheBy
Atlas Antibodies Anti-TGFBRAP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TGFBRAP1 Antibody

상품 한눈에 보기

Human TGFBRAP1을 표적으로 하는 폴리클로날 항체로, WB 및 ICC 응용에 적합함. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제됨. 인간, Rat, Mouse 종에서 교차 반응성이 확인됨. 안정한 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA037672-100 Anti-TGFBRAP1 Antibody, transforming growth factor, beta receptor associated protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037672-25 Anti-TGFBRAP1 Antibody, transforming growth factor, beta receptor associated protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TGFBRAP1 Antibody

Anti-TGFBRAP1 Antibody

Target: transforming growth factor, beta receptor associated protein 1
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TGFBRAP1


Alternative Gene Names

  • TRAP-1
  • TRAP1

Open Datasheet


Target Information

항목 내용
Target Protein transforming growth factor, beta receptor associated protein 1
Target Gene TGFBRAP1
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000024562 (90%), Mouse ENSMUSG00000070939 (88%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SAAWLEKHKKYFALGLLYHYNNQDAAAVQLWVNIVNGDVQDSTRSDLYEYIVDFLTYCLDEELVWAYADWVLQKSEEVGVQVFTKRPLDEQQKNSFNPDD

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

WB icon
ICC icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.