CacheBy
Atlas Antibodies Anti-TCF7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCF7 Antibody

상품 한눈에 보기

인간 TCF7 단백질을 인식하는 토끼 폴리클로날 항체로, 전사인자 연구에 적합합니다. PrEST 항원으로 친화 정제되었으며, 인체에 높은 반응성을 보입니다. 세포 내 단백질 발현 및 위치 분석에 활용 가능합니다.

카탈로그번호
HPA070505-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070505-100 Anti-TCF7 Antibody, transcription factor 7 (T-cell specific, HMG-box) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070505-25 Anti-TCF7 Antibody, transcription factor 7 (T-cell specific, HMG-box) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCF7 Antibody

Anti-TCF7 Antibody

Target: transcription factor 7 (T-cell specific, HMG-box)
Type: Polyclonal Antibody against Human TCF7


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against Human TCF7 (transcription factor 7, T-cell specific, HMG-box).


Alternative Gene Names

  • TCF-1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transcription factor 7 (T-cell specific, HMG-box)
Target Gene TCF7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KKCIRYLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFPTELLTSPAE
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000049232 (38%), Mouse ENSMUSG00000024985 (38%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.