CacheBy
Atlas Antibodies Anti-TCF3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCF3 Antibody

상품 한눈에 보기

인간 TCF3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 다양한 종에서 교차 반응 가능성 있음. 40% 글리세롤 및 PBS 완충액에 보존됨.

카탈로그번호
HPA062476-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062476-100 Anti-TCF3 Antibody, transcription factor 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062476-25 Anti-TCF3 Antibody, transcription factor 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCF3 Antibody

Anti-TCF3 Antibody

Product Description

Polyclonal antibody against human transcription factor 3 (TCF3). Suitable for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.

Alternative Gene Names

bHLHb21, E2A, E47, ITF1, MGC129647, MGC129648, VDIR

Open Datasheet

Target Information

항목 내용
Target Protein Transcription factor 3
Target Gene TCF3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS

Verified Species Reactivity

Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000020167 74%
Rat ENSRNOG00000051499 71%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.