
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TCEAL8 Antibody
상품 한눈에 보기
인간 TCEAL8 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, Rabbit IgG 형식으로 제공됩니다. PBS/glycerol buffer에 sodium azide 보존제가 포함되어 있습니다.
- 카탈로그번호
- HPA059115-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA059115-100 Anti-TCEAL8 Antibody, transcription elongation factor A (SII)-like 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059115-25 Anti-TCEAL8 Antibody, transcription elongation factor A (SII)-like 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TCEAL8 Antibody
Anti-TCEAL8 Antibody
Target: transcription elongation factor A (SII)-like 8
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human TCEAL8.
Alternative Gene Names
MGC45400, WEX3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transcription elongation factor A (SII)-like 8 |
| Target Gene | TCEAL8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFR |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000028585 (71%), Mouse ENSMUSG00000051579 (71%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



