Atlas Antibodies Anti-TCEAL7 Antibody

상품 한눈에 보기

Human TCEAL7 단백질을 인식하는 폴리클로날 항체로, IHC 정량 분석 및 RNA-seq 데이터 기반 정합 검증에 적합. Rabbit 유래 IgG로 정제된 고특이성 항체이며, Human에 대한 반응이 검증됨. 40% glycerol 기반 buffer에 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051507-100 Anti-TCEAL7 Antibody, transcription elongation factor A (SII)-like 7 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051507-25 Anti-TCEAL7 Antibody, transcription elongation factor A (SII)-like 7 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: transcription elongation factor A (SII)-like 7
Type: Polyclonal Antibody against Human TCEAL7

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody raised in rabbit against Human TCEAL7.

MGC23947, WEX5

Target Protein: transcription elongation factor A (SII)-like 7
Target Gene: TCEAL7
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

FKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000037645	81%
Mouse	ENSMUSG00000079428	79%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using PrEST antigen as affinity ligand