CacheBy
Atlas Antibodies Anti-TCEAL7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCEAL7 Antibody

상품 한눈에 보기

Human TCEAL7 단백질을 인식하는 폴리클로날 항체로, IHC 정량 분석 및 RNA-seq 데이터 기반 정합 검증에 적합. Rabbit 유래 IgG로 정제된 고특이성 항체이며, Human에 대한 반응이 검증됨. 40% glycerol 기반 buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA051507-100 Anti-TCEAL7 Antibody, transcription elongation factor A (SII)-like 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051507-25 Anti-TCEAL7 Antibody, transcription elongation factor A (SII)-like 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCEAL7 Antibody

Anti-TCEAL7 Antibody

Target: transcription elongation factor A (SII)-like 7
Type: Polyclonal Antibody against Human TCEAL7

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody raised in rabbit against Human TCEAL7.

Alternative Gene Names

MGC23947, WEX5

Open Datasheet (PDF)

Target Information

  • Target Protein: transcription elongation factor A (SII)-like 7
  • Target Gene: TCEAL7
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000037645 81%
Mouse ENSMUSG00000079428 79%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.