CacheBy
Atlas Antibodies Anti-TANC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TANC1 Antibody

상품 한눈에 보기

Human TANC1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 특이성을 가짐. 40% 글리세롤 기반 완충액에 보존되어 안정적 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036750-100 Anti-TANC1 Antibody, tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036750-25 Anti-TANC1 Antibody, tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TANC1 Antibody

Anti-TANC1 Antibody

Target: tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1 (TANC1)
Type: Polyclonal Antibody against Human TANC1
Host: Rabbit
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

This polyclonal antibody is raised in rabbit against the human TANC1 protein. It recognizes the recombinant protein epitope signature tag (PrEST) antigen sequence of TANC1.


Alternative Gene Names

  • KIAA1728
  • ROLSB

Target Information

항목 내용
Target Protein tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1
Target Gene TANC1
Antigen Sequence LQEGLQSKGRPVSPQSRAGIGKSLREPVAQPGLLLQPSKQAQIVKTSQHLGSGQSAVRNGSMKVQISSQNPPPSPMPGRIAATP
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000025394 (81%), Mouse ENSMUSG00000035168 (79%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.