
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TANC1 Antibody
상품 한눈에 보기
Human TANC1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 특이성을 가짐. 40% 글리세롤 기반 완충액에 보존되어 안정적 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036750-100 Anti-TANC1 Antibody, tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036750-25 Anti-TANC1 Antibody, tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TANC1 Antibody
Anti-TANC1 Antibody
Target: tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1 (TANC1)
Type: Polyclonal Antibody against Human TANC1
Host: Rabbit
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
This polyclonal antibody is raised in rabbit against the human TANC1 protein. It recognizes the recombinant protein epitope signature tag (PrEST) antigen sequence of TANC1.
Alternative Gene Names
- KIAA1728
- ROLSB
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1 |
| Target Gene | TANC1 |
| Antigen Sequence | LQEGLQSKGRPVSPQSRAGIGKSLREPVAQPGLLLQPSKQAQIVKTSQHLGSGQSAVRNGSMKVQISSQNPPPSPMPGRIAATP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000025394 (81%), Mouse ENSMUSG00000035168 (79%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



