
Atlas Antibodies Anti-TANC1 Antibody
상품 한눈에 보기
Human TANC1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 특이성을 가짐. 40% 글리세롤 기반 완충액에 보존되어 안정적 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TANC1 Antibody
Target: tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1 (TANC1)
Type: Polyclonal Antibody against Human TANC1
Host: Rabbit
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
This polyclonal antibody is raised in rabbit against the human TANC1 protein. It recognizes the recombinant protein epitope signature tag (PrEST) antigen sequence of TANC1.
Alternative Gene Names
- KIAA1728
- ROLSB
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1 |
| Target Gene | TANC1 |
| Antigen Sequence | LQEGLQSKGRPVSPQSRAGIGKSLREPVAQPGLLLQPSKQAQIVKTSQHLGSGQSAVRNGSMKVQISSQNPPPSPMPGRIAATP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000025394 (81%), Mouse ENSMUSG00000035168 (79%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TANK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TANGO2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TANC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TAMM41 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TAOK1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.