AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TAMM41 Antibody
상품 한눈에 보기
인간 TAMM41 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. TAM41의 미토콘드리아 단백질 조립 연구에 유용합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044861-100 Anti-TAMM41 Antibody, TAM41 mitochondrial translocator assembly and maintenance homolog 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044861-25 Anti-TAMM41 Antibody, TAM41 mitochondrial translocator assembly and maintenance homolog 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TAMM41 Antibody
Anti-TAMM41 Antibody
제품 설명
Polyclonal Antibody against Human TAMM41 (mitochondrial translocator assembly and maintenance protein, homolog of S. cerevisiae)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Alternative Gene Names
C3orf31, DKFZp434E0519, MGC16471
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae) |
| Target Gene | TAMM41 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFL |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse | 78% sequence identity (ENSMUSG00000030316) |
| Rat | 76% sequence identity (ENSRNOG00000007874) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.