
Thermo Fisher Scientific GCLM Polyclonal Antibody
Thermo Fisher Scientific의 GCLM Polyclonal Antibody는 인간 GCLM 단백질을 인식하는 토끼 다클론 항체입니다. Western blot, IHC(P), ICC/IF에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. PBS 버퍼에 보관되며 연구용으로 적합합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific GCLM Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.04–0.4 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:200 |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human GCLM. Recombinant protein control fragment (Product # RP-93984) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Wet ice |
| RRID | AB_2789999 |
Product Specific Information
Immunogen sequence:
RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE
Target Information
Gamma-glutamylcysteine synthetase (gamma-GCS) is the rate limiting enzyme for glutathione (L-gamma-glutamyl-L-cysteinylglycine, GSH) synthesis.
GSH is ubiquitous in mammalian cells as a vital intra- and extracellular protective antioxidant.
Gamma-GCS is a heterodimer of a heavy catalytic subunit and a light regulatory subunit that is responsive to inflammation, phenolic antioxidants, heat shock, oxidants, and cytokines.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
