Thermo Fisher Scientific GCLM Polyclonal Antibody
Thermo Fisher Scientific의 GCLM Polyclonal Antibody는 인간 GCLM 단백질을 인식하는 토끼 다클론 항체입니다. Western blot, IHC(P), ICC/IF에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. PBS 버퍼에 보관되며 연구용으로 적합합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.04–0.4 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:200 |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human GCLM. Recombinant protein control fragment (Product # RP-93984) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Wet ice |
| RRID | AB_2789999 |
Product Specific Information
Immunogen sequence:
RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE
Target Information
Gamma-glutamylcysteine synthetase (gamma-GCS) is the rate limiting enzyme for glutathione (L-gamma-glutamyl-L-cysteinylglycine, GSH) synthesis.
GSH is ubiquitous in mammalian cells as a vital intra- and extracellular protective antioxidant.
Gamma-GCS is a heterodimer of a heavy catalytic subunit and a light regulatory subunit that is responsive to inflammation, phenolic antioxidants, heat shock, oxidants, and cytokines.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific WIZ Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Syntenin 1 Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GCLM Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific DAP3 Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ZNF23 Polyclonal Antibody
740,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|