CacheBy
Thermo Fisher Scientific MRP1 Monoclonal Antibody (IU5C1)
원본

Thermo Fisher Scientific MRP1 Monoclonal Antibody (IU5C1)

상품 한눈에 보기

MRP1 단백질을 인식하는 Thermo Fisher Scientific의 단클론 항체로, Western blot, IHC, ICC/IF에 사용 가능. 인간 및 마우스 반응성. Protein G로 정제된 액상 항체이며, PBS buffer와 0.1% sodium azide 포함. 연구용으로만 사용.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 04:36
Thermo Fisher Scientific MA516079 MRP1 Monoclonal Antibody (IU5C1) 100 ul pk판매 단위 pk ·
재고 확인 필요
699,000원VAT 포함 768,900원

Thermo Fisher Scientific · Thermo Fisher Scientific MRP1 Monoclonal Antibody (IU5C1)

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 1:250–1:500
Immunohistochemistry (Paraffin) (IHC (P)) 1:200
Immunocytochemistry (ICC/IF) 1:10–1:2,000

Product Specifications

항목 내용
Species Reactivity Human, Mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Clone IU5C1
Immunogen A recombinant peptide corresponding to residues 1–33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein
Conjugate Unconjugated
Form Liquid
Concentration 1.0 mg/mL
Purification Protein G
Storage Buffer PBS
Contains 0.1% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_11155852

Product Specific Information

  • The target sequence shows 96% sequence homology with rat, primate, and feline; 88% with chicken; 87% with bovine; 72% with Drosophila melanogaster.
  • Suggested positive control: 293 transfected lysate.

Target Information

The protein encoded by this gene belongs to the ATP-binding cassette (ABC) transporter superfamily. ABC transporters move various molecules across cellular membranes and are divided into seven subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).
This transporter is part of the MRP subfamily involved in multidrug resistance and functions as a multispecific organic anion transporter. It transports oxidized glutathione, cysteinyl leukotrienes, activated aflatoxin B1, as well as glucuronides and sulfate conjugates of steroid hormones and bile salts.
Alternative splicing results in several variants, all maintaining the original open reading frame.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.