Thermo Fisher Scientific MRP1 Monoclonal Antibody (IU5C1)
MRP1 단백질을 인식하는 Thermo Fisher Scientific의 단클론 항체로, Western blot, IHC, ICC/IF에 사용 가능. 인간 및 마우스 반응성. Protein G로 정제된 액상 항체이며, PBS buffer와 0.1% sodium azide 포함. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific MRP1 Monoclonal Antibody (IU5C1)
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:250–1:500 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:200 |
| Immunocytochemistry (ICC/IF) | 1:10–1:2,000 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Clone | IU5C1 |
| Immunogen | A recombinant peptide corresponding to residues 1–33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.0 mg/mL |
| Purification | Protein G |
| Storage Buffer | PBS |
| Contains | 0.1% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_11155852 |
Product Specific Information
- The target sequence shows 96% sequence homology with rat, primate, and feline; 88% with chicken; 87% with bovine; 72% with Drosophila melanogaster.
- Suggested positive control: 293 transfected lysate.
Target Information
The protein encoded by this gene belongs to the ATP-binding cassette (ABC) transporter superfamily. ABC transporters move various molecules across cellular membranes and are divided into seven subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).
This transporter is part of the MRP subfamily involved in multidrug resistance and functions as a multispecific organic anion transporter. It transports oxidized glutathione, cysteinyl leukotrienes, activated aflatoxin B1, as well as glucuronides and sulfate conjugates of steroid hormones and bile salts.
Alternative splicing results in several variants, all maintaining the original open reading frame.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.