Thermo Fisher Scientific MRP1 Monoclonal Antibody (IU5C1)
MRP1 단백질을 인식하는 Thermo Fisher Scientific의 단클론 항체로, Western blot, IHC, ICC/IF에 사용 가능. 인간 및 마우스 반응성. Protein G로 정제된 액상 항체이며, PBS buffer와 0.1% sodium azide 포함. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:250–1:500 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:200 |
| Immunocytochemistry (ICC/IF) | 1:10–1:2,000 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Clone | IU5C1 |
| Immunogen | A recombinant peptide corresponding to residues 1–33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.0 mg/mL |
| Purification | Protein G |
| Storage Buffer | PBS |
| Contains | 0.1% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_11155852 |
Product Specific Information
- The target sequence shows 96% sequence homology with rat, primate, and feline; 88% with chicken; 87% with bovine; 72% with Drosophila melanogaster.
- Suggested positive control: 293 transfected lysate.
Target Information
The protein encoded by this gene belongs to the ATP-binding cassette (ABC) transporter superfamily. ABC transporters move various molecules across cellular membranes and are divided into seven subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).
This transporter is part of the MRP subfamily involved in multidrug resistance and functions as a multispecific organic anion transporter. It transports oxidized glutathione, cysteinyl leukotrienes, activated aflatoxin B1, as well as glucuronides and sulfate conjugates of steroid hormones and bile salts.
Alternative splicing results in several variants, all maintaining the original open reading frame.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CIP2A Monoclonal Antibody (2G10), DyLight 488
715,600원
Thermo Fisher Scientific
Thermo Fisher Scientific CIP2A Monoclonal Antibody (2G10), HRP
721,400원
Thermo Fisher Scientific
Thermo Fisher Scientific MRP1 Monoclonal Antibody (IU5C1)
699,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CIP2A Monoclonal Antibody (2G10), DyLight 650
721,400원
Thermo Fisher Scientific
Thermo Fisher Scientific CITED4 Monoclonal Antibody (HT13-2D6.3), DyLight 488
721,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|