Atlas Antibodies Anti-SYK Antibody

상품 한눈에 보기

Human SYK 단백질을 인식하는 Rabbit Polyclonal Antibody로, spleen tyrosine kinase 검출에 적합. IHC 및 RNA-seq 기반 Orthogonal Validation 제공. PrEST 항원으로 Affinity 정제되어 높은 특이성과 재현성 보장.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001384-100 Anti-SYK Antibody, spleen tyrosine kinase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001384-25 Anti-SYK Antibody, spleen tyrosine kinase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SYK Antibody

Anti-SYK Antibody

Target: Spleen Tyrosine Kinase (SYK)
Type: Polyclonal Antibody against Human SYK
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody developed in rabbit against human spleen tyrosine kinase (SYK).
Validated and affinity purified using the PrEST antigen.

Open Datasheet

Specifications

항목	내용
Target Protein	Spleen tyrosine kinase
Target Gene	SYK
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	GLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNF
Verified Species Reactivity	Human
Interspecies Identity	Mouse (78%), Rat (77%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
Safety	Material Safety Data Sheet