Atlas Antibodies Anti-SYK Antibody
상품 한눈에 보기
Human SYK 단백질을 인식하는 Rabbit Polyclonal Antibody로, spleen tyrosine kinase 검출에 적합. IHC 및 RNA-seq 기반 Orthogonal Validation 제공. PrEST 항원으로 Affinity 정제되어 높은 특이성과 재현성 보장.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SYK Antibody
Target: Spleen Tyrosine Kinase (SYK)
Type: Polyclonal Antibody against Human SYK
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody developed in rabbit against human spleen tyrosine kinase (SYK).
Validated and affinity purified using the PrEST antigen.
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Spleen tyrosine kinase |
| Target Gene | SYK |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNF |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (78%), Rat (77%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.