CacheBy
Atlas Antibodies Anti-SYF2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SYF2 Antibody

상품 한눈에 보기

Human SYF2 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 Western Blot에 적합합니다. 고순도 affinity purification 방식으로 제조되었으며, Human, Mouse, Rat에 반응합니다. 안정한 PBS/glycerol buffer에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070710-100 Anti-SYF2 Antibody, SYF2 pre-mRNA-splicing factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070710-25 Anti-SYF2 Antibody, SYF2 pre-mRNA-splicing factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SYF2 Antibody

Anti-SYF2 Antibody

SYF2 pre-mRNA-splicing factor

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human SYF2.

Alternative Gene Names

CBPIN, DKFZp564O2082, fSAP29, NTC31, p29

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein SYF2 pre-mRNA-splicing factor
Target Gene SYF2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARG

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000028821 (84%)
  • Rat ENSRNOG00000060597 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.