Atlas Antibodies Anti-SWT1 Antibody
상품 한눈에 보기
Human SWT1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB(재조합 발현 검증), ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며 Rat, Mouse와의 교차 반응 가능성이 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SWT1 Antibody
SWT1 RNA endoribonuclease homolog (S. cerevisiae)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, recombinant expression validation)
- ICC (Immunocytochemistry)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human SWT1.
Alternative Gene Names
C1orf26, FLJ20121, HsSwt1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SWT1 RNA endoribonuclease homolog (S. cerevisiae) |
| Target Gene | SWT1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VRILKTTEVPGFDKLVLIIPWVVMQELDRMKEGKLLKRAQHKAIPAVHFINDSLKNQDRKLWGQSIQLASQKHYGLSDENNDDRVLKCCLQHQE |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000032258 (88%)
- Mouse ENSMUSG00000052748 (84%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.