CacheBy
Atlas Antibodies Anti-SWT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SWT1 Antibody

상품 한눈에 보기

Human SWT1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합. 재조합 발현 검증 완료. 고순도 Affinity 정제 방식으로 제조되었으며, 다양한 종 간 상동성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024214-100 Anti-SWT1 Antibody, SWT1 RNA endoribonuclease homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024214-25 Anti-SWT1 Antibody, SWT1 RNA endoribonuclease homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SWT1 Antibody

Anti-SWT1 Antibody

SWT1 RNA endoribonuclease homolog (S. cerevisiae)


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)
    • Recombinant expression validation in WB using target protein overexpression.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human SWT1


Alternative Gene Names

C1orf26, FLJ20121, HsSwt1

Open Datasheet


Target Information

항목 내용
Target Protein SWT1 RNA endoribonuclease homolog (S. cerevisiae)
Target Gene SWT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VRILKTTEVPGFDKLVLIIPWVVMQELDRMKEGKLLKRAQHKAIPAVHFINDSLKNQDRKLWGQSIQLASQKHYGLSDENNDDRVLKCCLQHQE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000032258 (88%), Mouse ENSMUSG00000052748 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.