CacheBy
Atlas Antibodies Anti-SV2B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SV2B Antibody

상품 한눈에 보기

인체 SV2B 단백질을 인식하는 폴리클로날 항체로, 신경 시냅스 소포 단백질 연구에 적합. 토끼 유래 IgG 형식이며, PrEST 항원으로 친화 정제됨. 인간에 반응하며, IHC 등 다양한 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046247-100 Anti-SV2B Antibody, synaptic vesicle glycoprotein 2B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046247-25 Anti-SV2B Antibody, synaptic vesicle glycoprotein 2B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SV2B Antibody

Anti-SV2B Antibody

Target: Synaptic vesicle glycoprotein 2B
Supplier: Atlas Antibodies

면역조직화학 (IHC)

Product Description

Polyclonal antibody against human SV2B.

Alternative Gene Names

HsT19680, KIAA0735

Open Datasheet

Target Information

  • Target Protein: Synaptic vesicle glycoprotein 2B
  • Target Gene: SV2B
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EYQGIPHPDDVKAKQAKMAPSRMDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGR

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000053025 84%
Rat ENSRNOG00000018094 45%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.