CacheBy
Atlas Antibodies Anti-SUV39H2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SUV39H2 Antibody

상품 한눈에 보기

Human SUV39H2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정성 검증과 RNA-seq 비교를 통한 정밀 검증 수행. 고순도 친화정제 방식으로 제조되었으며, 다양한 조직 내 단백질 발현 분석에 적합. Human에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057554-100 Anti-SUV39H2 Antibody, suppressor of variegation 3-9 homolog 2 (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057554-25 Anti-SUV39H2 Antibody, suppressor of variegation 3-9 homolog 2 (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SUV39H2 Antibody

Anti-SUV39H2 Antibody

suppressor of variegation 3-9 homolog 2 (Drosophila)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human SUV39H2.

Alternative Gene Names

FLJ23414, KMT1B

Open Datasheet

Target Information

항목 내용
Target Protein suppressor of variegation 3-9 homolog 2 (Drosophila)
Target Gene SUV39H2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPI

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Information Highest antigen sequence identity to the following orthologs:
• Rat ENSRNOG00000015585 (87%)
• Mouse ENSMUSG00000026646 (87%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.