
Atlas Antibodies Anti-SUPT20H Antibody
상품 한눈에 보기
인간 SUPT20H 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현), ICC에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 인간에 대한 검증 완료, 마우스·랫과 99% 서열 유사성.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SUPT20H Antibody
suppressor of Ty 20 homolog (S. cerevisiae)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human SUPT20H.
Alternative Gene Names
bA421P11.4, C13orf19, FAM48A, P38IP, SPT20
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | suppressor of Ty 20 homolog (S. cerevisiae) |
| Target Gene | SUPT20H |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGCVIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLICDVHSITSDNHKWTQED |
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000027751 | 99% |
| Rat | ENSRNOG00000059480 | 99% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SUPT20H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUPT3H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUPT20H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUPT16H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUOX Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.