
Atlas Antibodies Anti-SUOX Antibody
상품 한눈에 보기
인간 SUOX 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 토끼 IgG 형식입니다. 인간에 대한 검증된 반응성과 높은 종간 서열 유사성을 갖습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SUOX Antibody
Target: Sulfite oxidase (SUOX)
Type: Polyclonal Antibody against Human SUOX
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody targeting human sulfite oxidase (SUOX).
Affinity purified using the PrEST antigen as affinity ligand.
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Sulfite oxidase |
| Target Gene | SUOX |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGT |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000005987 (92%), Mouse ENSMUSG00000049858 (91%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Mix gently before use; determine optimal conditions experimentally. |
| Safety Data Sheet | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SUPT20H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUPT16H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUOX Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUOX Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SUN2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.