Atlas Antibodies Anti-SUOX Antibody

상품 한눈에 보기

인간 SUOX 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 토끼 IgG 형식입니다. 인간에 대한 검증된 반응성과 높은 종간 서열 유사성을 갖습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038209-100 Anti-SUOX Antibody, sulfite oxidase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038209-25 Anti-SUOX Antibody, sulfite oxidase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SUOX Antibody

Anti-SUOX Antibody

Target: Sulfite oxidase (SUOX)
Type: Polyclonal Antibody against Human SUOX
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody targeting human sulfite oxidase (SUOX).
Affinity purified using the PrEST antigen as affinity ligand.
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

Specifications

항목	내용
Target Protein	Sulfite oxidase
Target Gene	SUOX
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGT
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000005987 (92%), Mouse ENSMUSG00000049858 (91%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Mix gently before use; determine optimal conditions experimentally.
Safety Data Sheet	Material Safety Data Sheet