Atlas Antibodies Anti-SUGP1 Antibody

상품 한눈에 보기

인간 SUGP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 유전자 기반 검증 완료. Recombinant PrEST 항원으로 정제되었으며 인간, 마우스, 랫트 반응성 확인. RNA-seq 및 siRNA 노크다운을 통한 정밀 검증 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA004890-100 Anti-SUGP1 Antibody, SURP and G patch domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA004890-25 Anti-SUGP1 Antibody, SURP and G patch domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: SURP and G patch domain containing 1
Supplier: Atlas Antibodies

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Genetic Validation: Genetic validation in WB by siRNA knockdown.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against human SUGP1.

DKFZp434E2216, F23858, RBP, SF4

항목	내용
Target Protein	SURP and G patch domain containing 1
Target Gene	SUGP1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence (AA)	GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPT
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Mouse ENSMUSG00000011306 (86%), Rat ENSRNOG00000052111 (83%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
MSDS	Material Safety Data Sheet