Atlas Antibodies Anti-SUGP1 Antibody
상품 한눈에 보기
인간 SUGP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 유전자 기반 검증 완료. Recombinant PrEST 항원으로 정제되었으며 인간, 마우스, 랫트 반응성 확인. RNA-seq 및 siRNA 노크다운을 통한 정밀 검증 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SUGP1 Antibody
Target: SURP and G patch domain containing 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB Genetic Validation: Genetic validation in WB by siRNA knockdown.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against human SUGP1.
Alternative Gene Names
DKFZp434E2216, F23858, RBP, SF4
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | SURP and G patch domain containing 1 |
| Target Gene | SUGP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence (AA) | GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPT |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Mouse ENSMUSG00000011306 (86%), Rat ENSRNOG00000052111 (83%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| MSDS | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.