
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SUFU Antibody
상품 한눈에 보기
Human SUFU 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG입니다. IHC, WB, ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인체 SUFU 단백질 검출 연구에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA008700-100 Anti-SUFU Antibody, suppressor of fused homolog (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008700-25 Anti-SUFU Antibody, suppressor of fused homolog (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SUFU Antibody
Anti-SUFU Antibody
Target: suppressor of fused homolog (Drosophila)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human SUFU.
Alternative Gene Names
PRO1280, SUFUH, SUFUXL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | suppressor of fused homolog (Drosophila) |
| Target Gene | SUFU |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | TEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESDSSTA |
Species Reactivity
| 종 | 항원 서열 유사도 |
|---|---|
| Human | Verified |
| Mouse | 97% (ENSMUSG00000025231) |
| Rat | 95% (ENSRNOG00000019807) |
Additional Information
| 항목 | 내용 |
|---|---|
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



