
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-STUB1 Antibody
상품 한눈에 보기
Human STUB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. STUB1 관련 단백질 발현 연구 및 유비퀴틴 리가아제 기능 분석에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041222-100 Anti-STUB1 Antibody, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041222-25 Anti-STUB1 Antibody, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-STUB1 Antibody
Anti-STUB1 Antibody
STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
Recommended Applications
- IHC (Independent antibody validation)
- WB (Western Blot)
Validation of protein expression in IHC
Comparing independent antibodies targeting different epitopes of the protein ensures reliable expression data.
Product Description
Polyclonal antibody against Human STUB1
Alternative Gene Names
CHIP, HSPABP2, NY-CO-7, SDCCAG7, UBOX1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase |
| Target Gene | STUB1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000039615 (100%), Rat ENSRNOG00000019798 (100%) |
Antigen Sequence:CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



