
Atlas Antibodies Anti-STUB1 Antibody
상품 한눈에 보기
Human STUB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. STUB1 관련 단백질 발현 연구 및 유비퀴틴 리가아제 기능 분석에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-STUB1 Antibody
STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
Recommended Applications
- IHC (Independent antibody validation)
- WB (Western Blot)
Validation of protein expression in IHC
Comparing independent antibodies targeting different epitopes of the protein ensures reliable expression data.
Product Description
Polyclonal antibody against Human STUB1
Alternative Gene Names
CHIP, HSPABP2, NY-CO-7, SDCCAG7, UBOX1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase |
| Target Gene | STUB1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000039615 (100%), Rat ENSRNOG00000019798 (100%) |
Antigen Sequence:CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
