CacheBy
Atlas Antibodies Anti-STUB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STUB1 Antibody

상품 한눈에 보기

Human STUB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. STUB1 관련 단백질 발현 연구 및 유비퀴틴 리가아제 기능 분석에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041222-100 Anti-STUB1 Antibody, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041222-25 Anti-STUB1 Antibody, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STUB1 Antibody

Anti-STUB1 Antibody

STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase

  • IHC (Independent antibody validation)
  • WB (Western Blot)

Validation of protein expression in IHC
Comparing independent antibodies targeting different epitopes of the protein ensures reliable expression data.

Product Description

Polyclonal antibody against Human STUB1

Alternative Gene Names

CHIP, HSPABP2, NY-CO-7, SDCCAG7, UBOX1

Open Datasheet

Target Information

항목 내용
Target Protein STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
Target Gene STUB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000039615 (100%), Rat ENSRNOG00000019798 (100%)

Antigen Sequence:
CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
Independent Validation
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.