Atlas Antibodies Anti-STT3B Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA036646-100 | - | Atlas Antibodies HPA036646-100 Anti-STT3B Antibody, STT3B, subunit of the oligosaccharyltransferase complex (catalytic) 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA036646-25 | - | Atlas Antibodies HPA036646-25 Anti-STT3B Antibody, STT3B, subunit of the oligosaccharyltransferase complex (catalytic) 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-STT3B Antibody
STT3B, subunit of the oligosaccharyltransferase complex (catalytic)
Recommended Applications
Product Description
Polyclonal Antibody against Human STT3B
Alternative Gene Names
FLJ90106, SIMP, STT3-B
Target Protein
STT3B, subunit of the oligosaccharyltransferase complex (catalytic)
Target Gene
STT3B
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
KAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIK
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000011922 (95%)
Mouse ENSMUSG00000032437 (92%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|